Lineage for d1bd4c_ (1bd4 C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72728Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 72729Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 72730Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 72817Protein Uracil PRTase [53293] (2 species)
  7. 72822Species Toxoplasma gondii [TaxId:5811] [53295] (4 PDB entries)
  8. 72833Domain d1bd4c_: 1bd4 C: [34108]

Details for d1bd4c_

PDB Entry: 1bd4 (more details), 2.2 Å

PDB Description: uprt-uracil complex

SCOP Domain Sequences for d1bd4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd4c_ c.61.1.1 (C:) Uracil PRTase {Toxoplasma gondii}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

SCOP Domain Coordinates for d1bd4c_:

Click to download the PDB-style file with coordinates for d1bd4c_.
(The format of our PDB-style files is described here.)

Timeline for d1bd4c_: