| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (28 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
| Domain d5wkea2: 5wke A:184-278 [341077] Other proteins in same PDB: d5wkea1, d5wkea3, d5wkeb_ automated match to d3l9ra2 complexed with bma, cl, cuy, edo, fuc, man, na, nag, p50 |
PDB Entry: 5wke (more details), 1.69 Å
SCOPe Domain Sequences for d5wkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wkea2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr
Timeline for d5wkea2: