Lineage for d5wkea2 (5wke A:184-278)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032475Domain d5wkea2: 5wke A:184-278 [341077]
    Other proteins in same PDB: d5wkea1, d5wkea3, d5wkeb_
    automated match to d3l9ra2
    complexed with bma, cl, cuy, edo, fuc, man, na, nag, p50

Details for d5wkea2

PDB Entry: 5wke (more details), 1.69 Å

PDB Description: crystal structure of human cd1b in complex with ps
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkea2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr

SCOPe Domain Coordinates for d5wkea2:

Click to download the PDB-style file with coordinates for d5wkea2.
(The format of our PDB-style files is described here.)

Timeline for d5wkea2:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wkeb_