Lineage for d5xjfc1 (5xjf C:87-174)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031930Protein automated matches [190803] (2 species)
    not a true protein
  7. 2031931Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)
  8. 2031980Domain d5xjfc1: 5xjf C:87-174 [341073]
    Other proteins in same PDB: d5xjfa1, d5xjfa2, d5xjfb1, d5xjfb2
    automated match to d1fnla2
    complexed with bma, cl, fuc, gal, man, nag; mutant

Details for d5xjfc1

PDB Entry: 5xjf (more details), 2.5 Å

PDB Description: crystal structure of fucosylated igg fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5xjfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjfc1 b.1.1.4 (C:87-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititq

SCOPe Domain Coordinates for d5xjfc1:

Click to download the PDB-style file with coordinates for d5xjfc1.
(The format of our PDB-style files is described here.)

Timeline for d5xjfc1: