Lineage for d5xjfc1 (5xjf C:87-174)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753603Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753612Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
    Uniprot O75015 23-189
  8. 2753621Domain d5xjfc1: 5xjf C:87-174 [341073]
    Other proteins in same PDB: d5xjfa1, d5xjfa2, d5xjfb1, d5xjfb2
    automated match to d1fnla2
    complexed with cl, nag; mutant

Details for d5xjfc1

PDB Entry: 5xjf (more details), 2.5 Å

PDB Description: crystal structure of fucosylated igg fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5xjfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjfc1 b.1.1.4 (C:87-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititq

SCOPe Domain Coordinates for d5xjfc1:

Click to download the PDB-style file with coordinates for d5xjfc1.
(The format of our PDB-style files is described here.)

Timeline for d5xjfc1: