SCOPe 2.08: Domain d1bd4b_: 1bd4 B:

Lineage for d1bd4b_ (1bd4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries)

8. Domain d1bd4b_: 1bd4 B: [34107]
   complexed with po4, ura

Details for d1bd4b_

PDB Entry: 1bd4, 2.2 Å

PDB Description: uprt-uracil complex

PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1bd4b_:

Sequence; same for both SEQRES and ATOM records:

>d1bd4b_ c.61.1.1 (B:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

Timeline for d1bd4b_:

• d1bd4b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bd4b_ appears in SCOPe 2.07