Lineage for d5o6se1 (5o6s E:1-73)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177487Protein Ubiquitin [54238] (8 species)
  7. 2177587Species Human (Homo sapiens) [TaxId:9606] [54239] (209 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2177941Domain d5o6se1: 5o6s E:1-73 [341069]
    Other proteins in same PDB: d5o6sa2, d5o6sb2, d5o6sc2, d5o6sd2, d5o6se2, d5o6sf2
    automated match to d5ibkc_

Details for d5o6se1

PDB Entry: 5o6s (more details), 2.9 Å

PDB Description: ubv.b4r, a dimeric ubiquitin variant binding to birc4 ring
PDB Compounds: (E:) Polyubiquitin-B

SCOPe Domain Sequences for d5o6se1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o6se1 d.15.1.1 (E:1-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdyn
inkkstlllvvkf

SCOPe Domain Coordinates for d5o6se1:

Click to download the PDB-style file with coordinates for d5o6se1.
(The format of our PDB-style files is described here.)

Timeline for d5o6se1: