| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Ubiquitin [54238] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
| Domain d5o6se1: 5o6s E:1-73 [341069] Other proteins in same PDB: d5o6sa2, d5o6sb2, d5o6sc2, d5o6sd2, d5o6se2, d5o6sf2 automated match to d5ibkc_ |
PDB Entry: 5o6s (more details), 2.9 Å
SCOPe Domain Sequences for d5o6se1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o6se1 d.15.1.1 (E:1-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdyn
inkkstlllvvkf
Timeline for d5o6se1: