Lineage for d5tr4b_ (5tr4 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538652Protein Ubiquitin [54238] (9 species)
  7. 2538678Species Cow (Bos taurus) [TaxId:9913] [224919] (38 PDB entries)
  8. 2538739Domain d5tr4b_: 5tr4 B: [341066]
    automated match to d1otrb_
    complexed with 61t

Details for d5tr4b_

PDB Entry: 5tr4 (more details), 2.2 Å

PDB Description: structure of ubiquitin activating enzyme (uba1) in complex with ubiquitin and tak-243
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d5tr4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr4b_ d.15.1.1 (B:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5tr4b_:

Click to download the PDB-style file with coordinates for d5tr4b_.
(The format of our PDB-style files is described here.)

Timeline for d5tr4b_:

2538739
d5tr4b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5tr4d_