Lineage for d5wkie1 (5wki E:2-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1304 PDB entries)
  8. 2357273Domain d5wkie1: 5wki E:2-120 [341060]
    Other proteins in same PDB: d5wkia1, d5wkib_, d5wkid2
    automated match to d3o4le1
    complexed with act, cl, cuy, d3d, edo, fuc, na, nag

Details for d5wkie1

PDB Entry: 5wki (more details), 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex
PDB Compounds: (E:) PG90 TCR beta chain

SCOPe Domain Sequences for d5wkie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkie1 b.1.1.0 (E:2-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglp
sdrffaerpegsvstlkiqrtqqedsavylcasslaraqgasntgelffgegsrltvle

SCOPe Domain Coordinates for d5wkie1:

Click to download the PDB-style file with coordinates for d5wkie1.
(The format of our PDB-style files is described here.)

Timeline for d5wkie1: