Lineage for d5wkid2 (5wki D:111-200)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (983 PDB entries)
  8. 2353538Domain d5wkid2: 5wki D:111-200 [341053]
    Other proteins in same PDB: d5wkia1, d5wkia2, d5wkib_, d5wkid1, d5wkie1, d5wkie2
    automated match to d4z7vg2
    complexed with act, cl, cuy, d3d, edo, fuc, na, nag

Details for d5wkid2

PDB Entry: 5wki (more details), 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex
PDB Compounds: (D:) T-cell receptor alpha variable 26-1,TRA@ protein

SCOPe Domain Sequences for d5wkid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkid2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d5wkid2:

Click to download the PDB-style file with coordinates for d5wkid2.
(The format of our PDB-style files is described here.)

Timeline for d5wkid2: