SCOPe 2.08: Domain d5wkid2: 5wki D:111-200

Lineage for d5wkid2 (5wki D:111-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5wkid2: 5wki D:111-200 [341053]
   Other proteins in same PDB: d5wkia1, d5wkia2, d5wkib_, d5wkid1, d5wkie1, d5wkie2
   automated match to d4z7vg2
   complexed with act, cl, cuy, d3d, edo, na, nag

Details for d5wkid2

PDB Entry: 5wki, 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex

PDB Compounds: (D:) T-cell receptor alpha variable 26-1,TRA@ protein

SCOPe Domain Sequences for d5wkid2:

Sequence; same for both SEQRES and ATOM records:

>d5wkid2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

Timeline for d5wkid2:

• d5wkid2 first appeared in SCOPe 2.06
  
• d5wkid2 appears in SCOPe 2.07