![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1489 PDB entries) |
![]() | Domain d5wkid1: 5wki D:3-110 [341052] Other proteins in same PDB: d5wkia1, d5wkib_, d5wkid2 automated match to d4z7vg1 complexed with act, cl, cuy, d3d, edo, fuc, na, nag |
PDB Entry: 5wki (more details), 2.75 Å
SCOPe Domain Sequences for d5wkid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wkid1 b.1.1.0 (D:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} kttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemasl iitedrksstlilphatlrdtavyycivrvayrqkvtfgtgtklqvip
Timeline for d5wkid1: