Lineage for d5vk7a1 (5vk7 A:0-412)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147427Protein automated matches [190317] (5 species)
    not a true protein
  7. 2147484Species Sus scrofa [TaxId:9823] [330445] (5 PDB entries)
  8. 2147493Domain d5vk7a1: 5vk7 A:0-412 [341044]
    Other proteins in same PDB: d5vk7a2, d5vk7b2
    automated match to d3wzfa_

Details for d5vk7a1

PDB Entry: 5vk7 (more details), 1.9 Å

PDB Description: aspartate aminotransferase ph 4.0
PDB Compounds: (A:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d5vk7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vk7a1 c.67.1.1 (A:0-412) automated matches {Sus scrofa [TaxId: 9823]}
mappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveqr
iannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaefl
arwyngtnnkdtpvyvssptwenhngvfttagfkdirsyrywdtekrgldlqgflsdlen
apefsifvlhacahnptgtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawa
iryfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnpp
aqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqigm
fsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtkiq

SCOPe Domain Coordinates for d5vk7a1:

Click to download the PDB-style file with coordinates for d5vk7a1.
(The format of our PDB-style files is described here.)

Timeline for d5vk7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vk7a2