SCOPe 2.06: Domain d5tqob1: 5tqo B:6-149

Lineage for d5tqob1 (5tqo B:6-149)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)

8. Domain d5tqob1: 5tqo B:6-149 [341041]
   Other proteins in same PDB: d5tqoa2, d5tqob2
   automated match to d1ygea2
   complexed with fe; mutant

Details for d5tqob1

PDB Entry: 5tqo, 1.7 Å

PDB Description: lipoxygenase-1 (soybean) l546a/l754a mutant at 300k

PDB Compounds: (B:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5tqob1:

Sequence, based on SEQRES records:

>d5tqob1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d5tqob1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp
tlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvy
ntklyksvriffanhty

Timeline for d5tqob1:

• d5tqob1 is new in SCOPe 2.06-stable
  
• d5tqob1 appears in SCOPe 2.07
  
• d5tqob1 appears in the current release, SCOPe 2.08