Class b: All beta proteins [48724] (180 folds) |
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) |
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
Protein Plant lipoxigenase [49725] (2 species) |
Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries) |
Domain d5tqob1: 5tqo B:6-149 [341041] Other proteins in same PDB: d5tqoa2, d5tqob2 automated match to d1ygea2 complexed with fe; mutant |
PDB Entry: 5tqo (more details), 1.7 Å
SCOPe Domain Sequences for d5tqob1:
Sequence, based on SEQRES records: (download)
>d5tqob1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf vcnswvyntklyksvriffanhty
>d5tqob1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} hkikgtvvlmpknelevnnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp tlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvy ntklyksvriffanhty
Timeline for d5tqob1: