Lineage for d5tr0b1 (5tr0 B:6-149)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369212Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2369213Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2369214Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 2369218Protein Plant lipoxigenase [49725] (2 species)
  7. 2369219Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)
  8. 2369244Domain d5tr0b1: 5tr0 B:6-149 [341030]
    Other proteins in same PDB: d5tr0a2, d5tr0b2
    automated match to d1ygea2
    complexed with fe2; mutant

Details for d5tr0b1

PDB Entry: 5tr0 (more details), 1.85 Å

PDB Description: lipoxygenase-1 (soybean) l754a mutant at 293k
PDB Compounds: (B:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5tr0b1:

Sequence, based on SEQRES records: (download)

>d5tr0b1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d5tr0b1 b.12.1.1 (B:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnvdnlnaflgrsvslqlisatkadahgkgkvgkdtflegints
lptlgagesafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvynt
klyksvriffanhty

SCOPe Domain Coordinates for d5tr0b1:

Click to download the PDB-style file with coordinates for d5tr0b1.
(The format of our PDB-style files is described here.)

Timeline for d5tr0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tr0b2