Lineage for d1upfa_ (1upf A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183128Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 183129Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 183130Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 183236Protein Uracil PRTase [53293] (3 species)
  7. 183244Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries)
  8. 183249Domain d1upfa_: 1upf A: [34102]

Details for d1upfa_

PDB Entry: 1upf (more details), 2.3 Å

PDB Description: structure of the uracil phosphoribosyltransferase, mutant c128v bound to the drug 5-fluorouracil

SCOP Domain Sequences for d1upfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upfa_ c.61.1.1 (A:) Uracil PRTase {Toxoplasma gondii}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

SCOP Domain Coordinates for d1upfa_:

Click to download the PDB-style file with coordinates for d1upfa_.
(The format of our PDB-style files is described here.)

Timeline for d1upfa_: