SCOPe 2.06: Domain d5pgxb1: 5pgx B:24-289

Lineage for d5pgxb1 (5pgx B:24-289)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (23 PDB entries)

8. Domain d5pgxb1: 5pgx B:24-289 [341016]
   Other proteins in same PDB: d5pgxb2
   automated match to d3dwfc1
   complexed with 8kd, nap; mutant

Details for d5pgxb1

PDB Entry: 5pgx, 2.5 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-(2-benzyl-6-hydroxyadamantan-2-yl)-1-(3- hydroxyazetidin-1-yl)ethan-1-one

PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5pgxb1:

Sequence; same for both SEQRES and ATOM records:

>d5pgxb1 c.2.1.2 (B:24-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrw
ttllirnpcrkileelystsynmdrf

Timeline for d5pgxb1:

• d5pgxb1 is new in SCOPe 2.06-stable
  
• d5pgxb1 appears in SCOPe 2.07
  
• d5pgxb1 appears in the current release, SCOPe 2.08