Lineage for d5olya_ (5oly A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167118Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2167119Protein beta-Phosphoglucomutase [75174] (3 species)
  7. 2167141Species Lactococcus lactis [TaxId:1360] [188899] (3 PDB entries)
  8. 2167143Domain d5olya_: 5oly A: [341000]
    automated match to d1o08a_
    complexed with g6p, mg, mgf

Details for d5olya_

PDB Entry: 5oly (more details), 2 Å

PDB Description: 5-fluorotryptophan labeled beta-phosphoglucomutase in a closed conformation, monoclinic crystal form
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d5olya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5olya_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1360]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkq

SCOPe Domain Coordinates for d5olya_:

Click to download the PDB-style file with coordinates for d5olya_.
(The format of our PDB-style files is described here.)

Timeline for d5olya_: