![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
![]() | Family c.1.15.0: automated matches [191634] (1 protein) not a true family |
![]() | Protein automated matches [191168] (5 species) not a true protein |
![]() | Species Piromyces sp. [TaxId:73868] [340898] (12 PDB entries) |
![]() | Domain d5nhdc_: 5nhd C: [340999] automated match to d4xkmf_ complexed with ni, so4, xls, xyp, xys |
PDB Entry: 5nhd (more details), 1.8 Å
SCOPe Domain Sequences for d5nhdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nhdc_ c.1.15.0 (C:) automated matches {Piromyces sp. [TaxId: 73868]} keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt sgkqelyeaivamyq
Timeline for d5nhdc_: