Lineage for d5osda_ (5osd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979788Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2979789Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries)
  8. 2979810Domain d5osda_: 5osd A: [340994]
    automated match to d4deea_
    complexed with a9b, adp, cl, mg

Details for d5osda_

PDB Entry: 5osd (more details), 1.99 Å

PDB Description: crystal structure of aurora-a kinase in complex with an allosterically binding fragment
PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d5osda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5osda_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitansskps

SCOPe Domain Coordinates for d5osda_:

Click to download the PDB-style file with coordinates for d5osda_.
(The format of our PDB-style files is described here.)

Timeline for d5osda_: