Lineage for d1a4xa_ (1a4x A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183128Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 183129Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 183130Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 183236Protein Uracil PRTase [53293] (3 species)
  7. 183240Species Bacillus subtilis [TaxId:1423] [53294] (2 PDB entries)
  8. 183242Domain d1a4xa_: 1a4x A: [34096]

Details for d1a4xa_

PDB Entry: 1a4x (more details), 2.3 Å

PDB Description: pyrr, the bacillus subtilis pyrimidine biosynthetic operon repressor, hexameric form

SCOP Domain Sequences for d1a4xa_:

Sequence, based on SEQRES records: (download)

>d1a4xa_ c.61.1.1 (A:) Uracil PRTase {Bacillus subtilis}
kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
vgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalvd
vgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen

Sequence, based on observed residues (ATOM records): (download)

>d1a4xa_ c.61.1.1 (A:) Uracil PRTase {Bacillus subtilis}
kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
vgeiditlyreplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqla
vlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen

SCOP Domain Coordinates for d1a4xa_:

Click to download the PDB-style file with coordinates for d1a4xa_.
(The format of our PDB-style files is described here.)

Timeline for d1a4xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4xb_