Lineage for d5nh6c_ (5nh6 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839418Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2839419Protein automated matches [191168] (5 species)
    not a true protein
  7. 2839432Species Piromyces sp. [TaxId:73868] [340898] (15 PDB entries)
  8. 2839435Domain d5nh6c_: 5nh6 C: [340956]
    automated match to d4xkmf_
    complexed with mg, so4, xyl

Details for d5nh6c_

PDB Entry: 5nh6 (more details), 1.75 Å

PDB Description: crystal structure of xylose isomerase from piromyces e2 complexed with one mg2+ ion and xylitol
PDB Compounds: (C:) xylose isomerase

SCOPe Domain Sequences for d5nh6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nh6c_ c.1.15.0 (C:) automated matches {Piromyces sp. [TaxId: 73868]}
akeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqf
gggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlk
avvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagiel
gaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptk
hqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrg
dyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgm
damaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkq
tsgkqelyeaivamyq

SCOPe Domain Coordinates for d5nh6c_:

Click to download the PDB-style file with coordinates for d5nh6c_.
(The format of our PDB-style files is described here.)

Timeline for d5nh6c_: