Lineage for d1a3c__ (1a3c -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72728Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 72729Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 72730Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 72817Protein Uracil PRTase [53293] (2 species)
  7. 72818Species Bacillus subtilis [TaxId:1423] [53294] (2 PDB entries)
  8. 72819Domain d1a3c__: 1a3c - [34095]

Details for d1a3c__

PDB Entry: 1a3c (more details), 1.6 Å

PDB Description: pyrr, the bacillus subtilis pyrimidine biosynthetic operon repressor, dimeric form

SCOP Domain Sequences for d1a3c__:

Sequence, based on SEQRES records: (download)

>d1a3c__ c.61.1.1 (-) Uracil PRTase {Bacillus subtilis}
qkavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpv
tvgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalv
dvgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen

Sequence, based on observed residues (ATOM records): (download)

>d1a3c__ c.61.1.1 (-) Uracil PRTase {Bacillus subtilis}
qkavildeqairraltriahemiernkcilvgiktrgiylakrlaerieqiegnpvtvge
iditlyrndeplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqlav
lvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen

SCOP Domain Coordinates for d1a3c__:

Click to download the PDB-style file with coordinates for d1a3c__.
(The format of our PDB-style files is described here.)

Timeline for d1a3c__: