SCOPe 2.08: Domain d5n4ha1: 5n4h A:58-163

Lineage for d5n4ha1 (5n4h A:58-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins)

6. Protein automated matches [272731] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [272732] (3 PDB entries)

8. Domain d5n4ha1: 5n4h A:58-163 [340948]
   Other proteins in same PDB: d5n4ha2
   automated match to d4wiqa1
   complexed with edo, peg; mutant

Details for d5n4ha1

PDB Entry: 5n4h, 1.7 Å

PDB Description: crystal structure of the d109n mutant of the mouse alpha-dystroglycan n-terminal region

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5n4ha1:

Sequence; same for both SEQRES and ATOM records:

>d5n4ha1 b.1.6.2 (A:58-163) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwnphshileg
lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepq

Timeline for d5n4ha1:

• d5n4ha1 first appeared in SCOPe 2.06
  
• d5n4ha1 appears in SCOPe 2.07