Lineage for d5n6nb_ (5n6n B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333685Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [340944] (1 PDB entry)
  8. 2333687Domain d5n6nb_: 5n6n B: [340945]
    automated match to d4dnkb_
    complexed with ca, suc

Details for d5n6nb_

PDB Entry: 5n6n (more details), 2.29 Å

PDB Description: crystal structure of the 14-3-3:neutral trehalase nth1 complex
PDB Compounds: (B:) Protein BMH1

SCOPe Domain Sequences for d5n6nb_:

Sequence, based on SEQRES records: (download)

>d5n6nb_ a.118.7.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswri
vssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsattgeskvfy
ykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvfy
yeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d5n6nb_ a.118.7.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswri
vssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsattgeskvfy
ykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvfy
yeiqnspdkachlakqafddaiaelykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d5n6nb_:

Click to download the PDB-style file with coordinates for d5n6nb_.
(The format of our PDB-style files is described here.)

Timeline for d5n6nb_: