| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Macrophage elastase (MMP-12) [69780] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries) Uniprot P39900 106-263 ! Uniprot P39900 106-264 |
| Domain d5n5ja_: 5n5j A: [340936] automated match to d1y93a_ complexed with 8nt, ca, hae, zn |
PDB Entry: 5n5j (more details), 1.8 Å
SCOPe Domain Sequences for d5n5ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n5ja_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d5n5ja_: