Lineage for d6amsd1 (6ams D:1-117)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583961Species Pseudomonas aeruginosa [TaxId:208964] [340922] (1 PDB entry)
  8. 2583971Domain d6amsd1: 6ams D:1-117 [340923]
    automated match to d4tr8b1
    complexed with po4

Details for d6amsd1

PDB Entry: 6ams (more details), 2.39 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from pseudomonas aeruginosa
PDB Compounds: (D:) Beta sliding clamp

SCOPe Domain Sequences for d6amsd1:

Sequence, based on SEQRES records: (download)

>d6amsd1 d.131.1.0 (D:1-117) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mhftiqreallkplqlvagvverrqtlpvlsnvllvvegqqlsltgtdlevelvgrvvle
daaepgeitvparklmdickslpndvlidirveeqkllvkagrsrftlstlpandfp

Sequence, based on observed residues (ATOM records): (download)

>d6amsd1 d.131.1.0 (D:1-117) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mhftiqreallkplqlvagvverrtlpvlsnvllvvegqqlsltgtdlevelvgrvvled
aaepgeitvparklmdickslpndvlidirveeqkllvkagrsrftlstlpandfp

SCOPe Domain Coordinates for d6amsd1:

Click to download the PDB-style file with coordinates for d6amsd1.
(The format of our PDB-style files is described here.)

Timeline for d6amsd1: