Lineage for d5nhbc_ (5nhb C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424564Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2424876Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2424877Protein automated matches [191168] (5 species)
    not a true protein
  7. 2424890Species Piromyces sp. [TaxId:73868] [340898] (12 PDB entries)
  8. 2424937Domain d5nhbc_: 5nhb C: [340921]
    automated match to d4xkmf_
    complexed with fe2, so4

Details for d5nhbc_

PDB Entry: 5nhb (more details), 2.4 Å

PDB Description: crystal structure of xylose isomerase from piromyces e2 in complex with two fe2+ ions
PDB Compounds: (C:) xylose isomerase

SCOPe Domain Sequences for d5nhbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhbc_ c.1.15.0 (C:) automated matches {Piromyces sp. [TaxId: 73868]}
keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
sgkqelyeaivamyq

SCOPe Domain Coordinates for d5nhbc_:

Click to download the PDB-style file with coordinates for d5nhbc_.
(The format of our PDB-style files is described here.)

Timeline for d5nhbc_: