Lineage for d1stoa_ (1sto A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128442Protein Orotate PRTase [53290] (3 species)
  7. 2128446Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries)
  8. 2128450Domain d1stoa_: 1sto A: [34092]
    complexed with oh, omp

Details for d1stoa_

PDB Entry: 1sto (more details), 2.6 Å

PDB Description: crystal structure of orotate phosphoribosyltransferase
PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d1stoa_:

Sequence, based on SEQRES records: (download)

>d1stoa_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkaakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv

Sequence, based on observed residues (ATOM records): (download)

>d1stoa_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkaaggslvgsalqgrvmlvdd
vitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvisiitlk
dliayleekpdmaehlaavrayreefgv

SCOPe Domain Coordinates for d1stoa_:

Click to download the PDB-style file with coordinates for d1stoa_.
(The format of our PDB-style files is described here.)

Timeline for d1stoa_: