Lineage for d5h2qb_ (5h2q B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342869Species Trypanosoma brucei [TaxId:185431] [340862] (2 PDB entries)
  8. 2342871Domain d5h2qb_: 5h2q B: [340911]
    automated match to d2r8qa_
    complexed with lli, mg, zn

Details for d5h2qb_

PDB Entry: 5h2q (more details), 1.66 Å

PDB Description: crystal structure of t brucei phosphodiesterase b2 bound to compound 13e
PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d5h2qb_:

Sequence, based on SEQRES records: (download)

>d5h2qb_ a.211.1.0 (B:) automated matches {Trypanosoma brucei [TaxId: 185431]}
taitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfggleg
aertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdrtksnraqwervle

Sequence, based on observed residues (ATOM records): (download)

>d5h2qb_ a.211.1.0 (B:) automated matches {Trypanosoma brucei [TaxId: 185431]}
taitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfggleg
aertlafrsmidcvlatdmarhseflekylelmktvddsdhrqmtmdvlmkagdisnvtk
pfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapffqk
ivdaclqgmqwtvdrtksnraqwervle

SCOPe Domain Coordinates for d5h2qb_:

Click to download the PDB-style file with coordinates for d5h2qb_.
(The format of our PDB-style files is described here.)

Timeline for d5h2qb_: