Lineage for d5lgca_ (5lgc A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458862Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2459021Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2459022Protein automated matches [195982] (7 species)
    not a true protein
  7. 2459028Species Arthrobacter sp. [TaxId:1914985] [340900] (1 PDB entry)
  8. 2459029Domain d5lgca_: 5lgc A: [340901]
    automated match to d2vyoa_
    complexed with cbs

Details for d5lgca_

PDB Entry: 5lgc (more details), 2.09 Å

PDB Description: t48 deacetylase with substrate
PDB Compounds: (A:) ArCE4A

SCOPe Domain Sequences for d5lgca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lgca_ c.6.2.0 (A:) automated matches {Arthrobacter sp. [TaxId: 1914985]}
avdcattkcvaltfddgpgeytnrlldelseqhtpatffvlgknvkkypktlkrmvdegh
qigshtfdhkditkltaegiehevqwtdeaieqaagvkpqilrppygahgavydrlipyp
lvlwdvdtldwkhhdpqktvrialeeakpgsiilmhdihessvkavpqlvsklhdagytl
vtvdqlfagtdfkpakayd

SCOPe Domain Coordinates for d5lgca_:

Click to download the PDB-style file with coordinates for d5lgca_.
(The format of our PDB-style files is described here.)

Timeline for d5lgca_: