![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
![]() | Family c.6.2.0: automated matches [195981] (1 protein) not a true family |
![]() | Protein automated matches [195982] (4 species) not a true protein |
![]() | Species Arthrobacter sp. [TaxId:1914985] [340900] (1 PDB entry) |
![]() | Domain d5lgca_: 5lgc A: [340901] automated match to d2vyoa_ complexed with cbs |
PDB Entry: 5lgc (more details), 2.09 Å
SCOPe Domain Sequences for d5lgca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lgca_ c.6.2.0 (A:) automated matches {Arthrobacter sp. [TaxId: 1914985]} avdcattkcvaltfddgpgeytnrlldelseqhtpatffvlgknvkkypktlkrmvdegh qigshtfdhkditkltaegiehevqwtdeaieqaagvkpqilrppygahgavydrlipyp lvlwdvdtldwkhhdpqktvrialeeakpgsiilmhdihessvkavpqlvsklhdagytl vtvdqlfagtdfkpakayd
Timeline for d5lgca_: