Lineage for d5n30a2 (5n30 A:179-303)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009372Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
    beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)
  4. 3009373Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family) (S)
  5. 3009374Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)
  6. 3009378Protein automated matches [272735] (2 species)
    not a true protein
  7. 3009381Species Mouse (Mus musculus) [TaxId:10090] [272736] (3 PDB entries)
  8. 3009384Domain d5n30a2: 5n30 A:179-303 [340897]
    Other proteins in same PDB: d5n30a1
    automated match to d4wiqa2
    complexed with edo, peg; mutant

Details for d5n30a2

PDB Entry: 5n30 (more details), 1.8 Å

PDB Description: crystal structure of the v72i mutant of the mouse alpha-dystroglycan n-terminal region
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5n30a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n30a2 d.272.1.1 (A:179-303) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
acaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia
nkkpt

SCOPe Domain Coordinates for d5n30a2:

Click to download the PDB-style file with coordinates for d5n30a2.
(The format of our PDB-style files is described here.)

Timeline for d5n30a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n30a1