SCOPe 2.08: Domain d5l12b_: 5l12 B:

Lineage for d5l12b_ (5l12 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein automated matches [190985] (6 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:357348] [340879] (1 PDB entry)

8. Domain d5l12b_: 5l12 B: [340880]
   automated match to d3ikfa_
   complexed with zn; mutant

Details for d5l12b_

PDB Entry: 5l12, 1.72 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant

PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5l12b_:

Sequence, based on SEQRES records:

>d5l12b_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 357348]}
mdfrigegydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaeaaalvvr

Sequence, based on observed residues (ATOM records):

>d5l12b_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 357348]}
mdfrigegydvhqlvpgrpliiggvtipyerglladvllhaitdalfgaaalgdigrhfs
dtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldl
pldrvnvkaktneklgylgrgegieaeaaalvvr

Timeline for d5l12b_:

• d5l12b_ first appeared in SCOPe 2.06
  
• d5l12b_ appears in SCOPe 2.07