SCOPe 2.08: Domain d3kuza1: 3kuz A:1198-1305

Lineage for d3kuza1 (3kuz A:1198-1305)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d3kuza1: 3kuz A:1198-1305 [340875]
   Other proteins in same PDB: d3kuza2, d3kuzb2
   automated match to d3q3ja_
   complexed with unx

Details for d3kuza1

PDB Entry: 3kuz, 2.3 Å

PDB Description: crystal structure of the ubiquitin like domain of plxnc1

PDB Compounds: (A:) Plexin-C1

SCOPe Domain Sequences for d3kuza1:

Sequence; same for both SEQRES and ATOM records:

>d3kuza1 d.15.1.0 (A:1198-1305) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvalnvvfekipenesadvcrnisvnvldcdtigqakekifqaflskngspyglqlneig
lelqmgtrqkelldidsssviledgitklntighyeisngstikvfkk

Timeline for d3kuza1:

• d3kuza1 first appeared in SCOPe 2.06
  
• d3kuza1 appears in SCOPe 2.07