SCOPe 2.08: Domain d3k01a1: 3k01 A:17-404

Lineage for d3k01a1 (3k01 A:17-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Streptomyces glaucescens [TaxId:1907] [255902] (4 PDB entries)

8. Domain d3k01a1: 3k01 A:17-404 [340871]
   Other proteins in same PDB: d3k01a2
   automated match to d3jzja_
   complexed with so4

Details for d3k01a1

PDB Entry: 3k01, 1.35 Å

PDB Description: crystal structures of the gach receptor of streptomyces glaucescens gla.o in the unliganded form and in complex with acarbose and an acarbose homolog. comparison with acarbose-loaded maltose binding protein of salmonella typhimurium.

PDB Compounds: (A:) Acarbose/maltose binding protein GacH

SCOPe Domain Sequences for d3k01a1:

Sequence; same for both SEQRES and ATOM records:

>d3k01a1 c.94.1.0 (A:17-404) automated matches {Streptomyces glaucescens [TaxId: 1907]}
elsgtvtfwdtsneaekatyqalaegfekehpkvdvkyvnvpfgeanakfknaaggnsga
pdvmrtevawvadfasigylapldgtpalddgsdhlpqaaastryegktyavpqvidtla
lfynkelltkagvevpgsvaelktaaaeitektgatglylrgddpywflpylygeggdlv
deknktvtvddeagvrayrvikdlvdskaaitdasdgwnnmqnafksgkvammvngpwai
edvkagarfkdagnlgvapvpagsagqgspqggwnlsvyagsknldasyafvkymssakv
qqqtteklsllptrtsvyevpsvadnemvkffkpavdkaverpwiaegnalfepirlqma
nvlsgetspdeaaantgdayrkllkdyk

Timeline for d3k01a1:

• d3k01a1 first appeared in SCOPe 2.06
  
• d3k01a1 appears in SCOPe 2.07