Lineage for d5h2ra_ (5h2r A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737560Species Trypanosoma brucei [TaxId:185431] [340862] (2 PDB entries)
  8. 2737563Domain d5h2ra_: 5h2r A: [340864]
    automated match to d2r8qa_
    complexed with lln, mg, zn

Details for d5h2ra_

PDB Entry: 5h2r (more details), 1.8 Å

PDB Description: crystal structure of t brucei phosphodiesterase b2 bound to compound 15b
PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d5h2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2ra_ a.211.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
aitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfgc
sdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllital
vhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfgglega
ertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdrtksnraqwervl

SCOPe Domain Coordinates for d5h2ra_:

Click to download the PDB-style file with coordinates for d5h2ra_.
(The format of our PDB-style files is described here.)

Timeline for d5h2ra_: