SCOPe 2.08: Domain d5h2qa_: 5h2q A:

Lineage for d5h2qa_ (5h2q A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:185431] [340862] (2 PDB entries)

8. Domain d5h2qa_: 5h2q A: [340863]
   automated match to d2r8qa_
   complexed with lli, mg, zn

Details for d5h2qa_

PDB Entry: 5h2q, 1.66 Å

PDB Description: crystal structure of t brucei phosphodiesterase b2 bound to compound 13e

PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d5h2qa_:

Sequence; same for both SEQRES and ATOM records:

>d5h2qa_ a.211.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
aitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfgc
sdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllital
vhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfgglega
ertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdrtksnraqwervl

Timeline for d5h2qa_:

• d5h2qa_ first appeared in SCOPe 2.06
  
• d5h2qa_ appears in SCOPe 2.07