Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (17 species) not a true protein |
Species Bacillus halodurans [TaxId:86665] [340856] (1 PDB entry) |
Domain d3fk9a1: 3fk9 A:2-153 [340857] Other proteins in same PDB: d3fk9a2, d3fk9b2 automated match to d1irya_ |
PDB Entry: 3fk9 (more details), 2.5 Å
SCOPe Domain Sequences for d3fk9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fk9a1 d.113.1.0 (A:2-153) automated matches {Bacillus halodurans [TaxId: 86665]} qrvtncivvdhdqvlllqkprrgwwvapggkmeagesiletvkreyweetgitvknpelk gifsmvifdegkivsewmlftfkatehegemlkqspegklewkkkdevlelpmaagdkwi fkhvlhsdrllygtfhytpdfellsyrldpep
Timeline for d3fk9a1: