Lineage for d1tc2a_ (1tc2 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily) Superfamily c.61.1: PRTase-like [53271] (2 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins) 
Protein Hypoxanthine PRTase [53286] (1 species) Species Trypanosoma cruzi [TaxId:5693] [53287] (2 PDB entries) 
Domain d1tc2a_: 1tc2 A: [34085]
Details for d1tc2a_
PDB Entry: 1tc2 (more details), 1.81 Å
PDB Description: ternary substrate complex of the hypoxanthine phosphoribosyltransferase from trypanosoma cruzi
SCOP Domain Sequences for d1tc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tc2a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlnyly
hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
lrpevy
SCOP Domain Coordinates for d1tc2a_:
Click to download the PDB-style file with coordinates for d1tc2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tc2a_:
- d1tc2a_ appears in SCOP 1.57
- d1tc2a_ appears in the current release, SCOPe 2.08
View in 3D
