Lineage for d6amqa3 (6amq A:245-366)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977328Species Enterobacter cloacae [TaxId:1045856] [340820] (1 PDB entry)
  8. 2977331Domain d6amqa3: 6amq A:245-366 [340838]
    automated match to d1ok7a3
    complexed with so4

Details for d6amqa3

PDB Entry: 6amq (more details), 2.67 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from enterobacter cloacae
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6amqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amqa3 d.131.1.0 (A:245-366) automated matches {Enterobacter cloacae [TaxId: 1045856]}
rrvlpknpdktleagcdslkqafaraailsnekfrgvrlyvsenqikitannpeqeeaee
ildvtyagtemeigfnvsyvldvlnalkcenvrilltdsvssvqiedaasqsaayvvmpm
rl

SCOPe Domain Coordinates for d6amqa3:

Click to download the PDB-style file with coordinates for d6amqa3.
(The format of our PDB-style files is described here.)

Timeline for d6amqa3: