SCOPe 2.06: Domain d6b8va_: 6b8v A:

Lineage for d6b8va_ (6b8v A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (3 species)
   not a true protein

7. Species Cryptococcus neoformans [TaxId:5207] [340815] (1 PDB entry)

8. Domain d6b8va_: 6b8v A: [340833]
   automated match to d1m7ga_
   complexed with gol

Details for d6b8va_

PDB Entry: 6b8v, 2.55 Å

PDB Description: crystal structure of adenylyl-sulfate kinase from cryptococcus neoformans

PDB Compounds: (A:) Adenylylsulfate kinase

SCOPe Domain Sequences for d6b8va_:

Sequence, based on SEQRES records:

>d6b8va_ c.37.1.4 (A:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk
dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie
vfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtdevdvagavei
itkyladnglipa

Sequence, based on observed residues (ATOM records):

>d6b8va_ c.37.1.4 (A:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk
dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie
vfidappyeapanpeihirtdevdvagaveiitkyladnglipa

Timeline for d6b8va_:

• d6b8va_ is new in SCOPe 2.06-stable
  
• d6b8va_ appears in SCOPe 2.07
  
• d6b8va_ appears in the current release, SCOPe 2.08