![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
![]() | Protein automated matches [191258] (3 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [340828] (2 PDB entries) |
![]() | Domain d6eo0b1: 6eo0 B:28-298 [340831] Other proteins in same PDB: d6eo0a2, d6eo0b2, d6eo0c2, d6eo0d2 automated match to d2b4ya1 complexed with bv8, bvt, edo, zn |
PDB Entry: 6eo0 (more details), 2.4 Å
SCOPe Domain Sequences for d6eo0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eo0b1 c.31.1.5 (B:28-298) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} kmtrpssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdlatpeaf srdpslvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidelhhrags khvyeihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellprcerks cngllrphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqvasrgvpv aefnmectpatqrfkyhfegpcgstlppale
Timeline for d6eo0b1: