Lineage for d6enxa_ (6enx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444630Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2444631Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2444911Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2445000Protein automated matches [191258] (3 species)
    not a true protein
  7. 2445014Species Zebrafish (Danio rerio) [TaxId:7955] [340828] (2 PDB entries)
  8. 2445015Domain d6enxa_: 6enx A: [340830]
    automated match to d2b4ya1
    complexed with bjw, dms, zn

Details for d6enxa_

PDB Entry: 6enx (more details), 1.95 Å

PDB Description: zebrafish sirt5 in complex with stalled bicyclic intermediate of inhibitory compound 10
PDB Compounds: (A:) NAD-dependent protein deacylase sirtuin-5, mitochondrial

SCOPe Domain Sequences for d6enxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enxa_ c.31.1.5 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
pssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdlatpeafsrdp
slvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidelhhragskhvy
eihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellprcerkscngl
lrphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqvasrgvpvaefn
mectpatqrfkyhfegpcgstlppale

SCOPe Domain Coordinates for d6enxa_:

Click to download the PDB-style file with coordinates for d6enxa_.
(The format of our PDB-style files is described here.)

Timeline for d6enxa_: