SCOPe 2.06: Domain d1tc1a_: 1tc1 A:

Lineage for d1tc1a_ (1tc1 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
   Uniprot Q27796

8. Domain d1tc1a_: 1tc1 A: [34083]
   complexed with fmb, mes

Details for d1tc1a_

PDB Entry: 1tc1, 1.41 Å

PDB Description: a 1.4 angstrom crystal structure for the hypoxanthine phosphoribosyltransferase of trypanosoma cruzi

PDB Compounds: (A:) protein (hypoxanthine phosphoribosyltransferase)

SCOPe Domain Sequences for d1tc1a_:

Sequence, based on SEQRES records:

>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlnyly
hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
lrpe

Sequence, based on observed residues (ATOM records):

>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssyvrmlldtrhsieghhvlivedivdtaltlnylyhmyftrrpa
slktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrpe

Timeline for d1tc1a_:

• d1tc1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1tc1a_ appears in SCOPe 2.05
  
• d1tc1a_ appears in SCOPe 2.07
  
• d1tc1a_ appears in the current release, SCOPe 2.08