SCOPe 2.08: Domain d6eo0d1: 6eo0 D:28-298

Lineage for d6eo0d1 (6eo0 D:28-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
   silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain

6. Protein automated matches [191258] (3 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [340828] (2 PDB entries)

8. Domain d6eo0d1: 6eo0 D:28-298 [340829]
   Other proteins in same PDB: d6eo0a2, d6eo0b2, d6eo0c2, d6eo0d2
   automated match to d2b4ya1
   complexed with bv8, bvt, edo, zn

Details for d6eo0d1

PDB Entry: 6eo0, 2.4 Å

PDB Description: zebrafish sirt5 in complex with stalled peptidylimidate and bicyclic intermediate of inhibitory compound 29

PDB Compounds: (D:) NAD-dependent protein deacylase sirtuin-5, mitochondrial

SCOPe Domain Sequences for d6eo0d1:

Sequence; same for both SEQRES and ATOM records:

>d6eo0d1 c.31.1.5 (D:28-298) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kmtrpssdltafrehfakakhiaiitgagvsaesgvptfrgpggfwrkwqaqdlatpeaf
srdpslvwefyhyrrevmrskmpnpahlaiaecearlgqqgrsvviitqnidelhhrags
khvyeihgslfktrcmscgevkanhkspicpaldgkgapdpntkearipvellprcerks
cngllrphvvwfgetldsdiltaverelekcdlclvvgtssivypaamfapqvasrgvpv
aefnmectpatqrfkyhfegpcgstlppale

Timeline for d6eo0d1:

• d6eo0d1 first appeared in SCOPe 2.06
  
• d6eo0d1 appears in SCOPe 2.07