Lineage for d6eqsb_ (6eqs B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444630Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2444631Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2444911Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2444957Protein NAD-dependent deacetylase sirtuin-5 [142128] (1 species)
  7. 2444958Species Human (Homo sapiens) [TaxId:9606] [142129] (5 PDB entries)
    Uniprot Q9NXA8 36-302
  8. 2444960Domain d6eqsb_: 6eqs B: [340827]
    Other proteins in same PDB: d6eqsc2, d6eqsd2
    automated match to d2b4ya1
    complexed with bu2, bv8, dms, edo, zn

Details for d6eqsb_

PDB Entry: 6eqs (more details), 1.32 Å

PDB Description: human sirt5 in complex with stalled peptidylimidate intermediate of inhibitory compound 29
PDB Compounds: (B:) NAD-dependent protein deacylase sirtuin-5, mitochondrial

SCOPe Domain Sequences for d6eqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eqsb_ c.31.1.5 (B:) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
rpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahn
psrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknl
leihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcgg
llrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaef
ntettpatnrfrfhfqgpcgttlpeala

SCOPe Domain Coordinates for d6eqsb_:

Click to download the PDB-style file with coordinates for d6eqsb_.
(The format of our PDB-style files is described here.)

Timeline for d6eqsb_: