![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
![]() | Protein automated matches [191220] (4 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:345073] [340824] (1 PDB entry) |
![]() | Domain d6b7jb1: 6b7j B:1-172 [340826] Other proteins in same PDB: d6b7ja2, d6b7jb2 automated match to d1mkaa_ complexed with fmt |
PDB Entry: 6b7j (more details), 1.44 Å
SCOPe Domain Sequences for d6b7jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b7jb1 d.38.1.2 (B:1-172) automated matches {Vibrio cholerae [TaxId: 345073]} mqnkrdsynredllassqgelfgegypqlpapnmlmmdritkmsetegefgkglilaeld itpdlwffdchfpgdpvmpgclgldamwqlvgfflgwvggkgkgralgvgevkftgqilp takkvtyeinmkrvvnrklvmgladgrvlvdgkeiyvakdlkvglfqdtsaf
Timeline for d6b7jb1: