Lineage for d6b7jb1 (6b7j B:1-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943682Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2943693Protein automated matches [191220] (4 species)
    not a true protein
  7. 2943747Species Vibrio cholerae [TaxId:345073] [340824] (1 PDB entry)
  8. 2943749Domain d6b7jb1: 6b7j B:1-172 [340826]
    Other proteins in same PDB: d6b7ja2, d6b7jb2
    automated match to d1mkaa_
    complexed with fmt

Details for d6b7jb1

PDB Entry: 6b7j (more details), 1.44 Å

PDB Description: the crystal structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (B:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d6b7jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b7jb1 d.38.1.2 (B:1-172) automated matches {Vibrio cholerae [TaxId: 345073]}
mqnkrdsynredllassqgelfgegypqlpapnmlmmdritkmsetegefgkglilaeld
itpdlwffdchfpgdpvmpgclgldamwqlvgfflgwvggkgkgralgvgevkftgqilp
takkvtyeinmkrvvnrklvmgladgrvlvdgkeiyvakdlkvglfqdtsaf

SCOPe Domain Coordinates for d6b7jb1:

Click to download the PDB-style file with coordinates for d6b7jb1.
(The format of our PDB-style files is described here.)

Timeline for d6b7jb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b7jb2