Lineage for d1cjbd_ (1cjb D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72728Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 72729Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 72730Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 72774Protein Hypoxantine-guanine PRTase (HGPRTase) [53283] (2 species)
  7. 72784Species Plasmodium falciparum [53285] (1 PDB entry)
  8. 72788Domain d1cjbd_: 1cjb D: [34082]

Details for d1cjbd_

PDB Entry: 1cjb (more details), 2 Å

PDB Description: malarial purine phosphoribosyltransferase

SCOP Domain Sequences for d1cjbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjbd_ c.61.1.1 (D:) Hypoxantine-guanine PRTase (HGPRTase) {Plasmodium falciparum}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

SCOP Domain Coordinates for d1cjbd_:

Click to download the PDB-style file with coordinates for d1cjbd_.
(The format of our PDB-style files is described here.)

Timeline for d1cjbd_: