Lineage for d6b8vb_ (6b8v B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123959Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2123979Protein automated matches [226942] (3 species)
    not a true protein
  7. 2123980Species Cryptococcus neoformans [TaxId:5207] [340815] (1 PDB entry)
  8. 2123982Domain d6b8vb_: 6b8v B: [340817]
    automated match to d1m7ga_
    complexed with gol

Details for d6b8vb_

PDB Entry: 6b8v (more details), 2.55 Å

PDB Description: crystal structure of adenylyl-sulfate kinase from cryptococcus neoformans
PDB Compounds: (B:) Adenylylsulfate kinase

SCOPe Domain Sequences for d6b8vb_:

Sequence, based on SEQRES records: (download)

>d6b8vb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk
dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie
vfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtdevdvagavei
itkyladnglipa

Sequence, based on observed residues (ATOM records): (download)

>d6b8vb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 5207]}
avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk
dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie
vfidappyeapanpeihirtdevdvagaveiitkyladnglipa

SCOPe Domain Coordinates for d6b8vb_:

Click to download the PDB-style file with coordinates for d6b8vb_.
(The format of our PDB-style files is described here.)

Timeline for d6b8vb_: