Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins) automatically mapped to Pfam PF01583 |
Protein automated matches [226942] (3 species) not a true protein |
Species Cryptococcus neoformans [TaxId:5207] [340815] (1 PDB entry) |
Domain d6b8vb_: 6b8v B: [340817] automated match to d1m7ga_ complexed with gol |
PDB Entry: 6b8v (more details), 2.55 Å
SCOPe Domain Sequences for d6b8vb_:
Sequence, based on SEQRES records: (download)
>d6b8vb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 5207]} avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie vfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtdevdvagavei itkyladnglipa
>d6b8vb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 5207]} avtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfglnk dlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaipfie vfidappyeapanpeihirtdevdvagaveiitkyladnglipa
Timeline for d6b8vb_: